PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676733134
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family G2-like
Protein Properties Length: 381aa    MW: 41983.6 Da    PI: 7.478
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676733134genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.6e-32228283156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
  676733134 228 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 283
                79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.049225285IPR017930Myb domain
SuperFamilySSF466891.34E-17225286IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-28226286IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-26228283IPR006447Myb domain, plants
PfamPF002496.2E-8230281IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MEIDYAQKMQ RCHEYVEALE EEQKKIQVFQ RELPLCLELV TQAIEACRKE LSNGTSTTSE  60
QCSEQTTSVC GGPVFEEFIP IKKSEEDGEH ESSPHEVEKS EGSTVDRKKS DWLRSVQLWN  120
PCPDPNTKDV SSSERVVVVA KKAKVVEVKP NSNNGGGFQP FQKEKKRVFS ETVMQPAVKP  180
DIPAPAPATT TCSTTETGGV DKAGEEQIQQ QQQQPQSQTQ TQTQTNRKQR RCWSPELHRR  240
FLHALQQLGG SHVATPKQIR DHMKVDGLTN DEVKSHLQKY RLHTRRPATS VTSQGNGNSQ  300
QPQFVVVGGI WVPSPQDFPP QSDGANNGGG VYAPVTAQPT PLPLPPQSPK RSMERSSGRC  360
NSPAASSSTN NTTTSSSSPV S
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013737217.11e-178PREDICTED: uncharacterized protein LOC106440164
TrEMBLM4FB941e-173M4FB94_BRARP; Uncharacterized protein
STRINGBra038360.1-P1e-173(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-121G2-like family protein